PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00016951-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 159aa    MW: 18383.1 Da    PI: 10.2934
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00016951-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.1e-1475120148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T+ E+  ++++ + lG++ W+tIa+ ++ gRt++++k++w+++l
  PSME_00016951-RA  75 RGSFTKAEERTILQLDAILGNR-WSTIASQLP-GRTENEIKNFWNSHL 120
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.4142969IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.6E-84076IPR009057Homeodomain-like
SuperFamilySSF466895.26E-1856128IPR009057Homeodomain-like
PROSITE profilePS5129422.56570124IPR017930Myb domain
SMARTSM007176.1E-1374122IPR001005SANT/Myb domain
PfamPF002499.0E-1375120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2477124IPR009057Homeodomain-like
CDDcd001671.99E-977120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MPPYCDSRRM RDSKRNLGFL SILVSSFVLI VMRREEGTSG HATWTALPEL AARLLRCGKT  60
YQLHWTNYLR PDVKRGSFTK AEERTILQLD AILGNRWSTI ASQLPGRTEN EIKNFWNSHL  120
KKRLLKMRLE YPSTHAPIEE VNLSDPRGYE ASALTRHEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-184012426108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135039.19e-45hypothetical protein PHAVU_010G096400g
RefseqXP_014516586.17e-45PREDICTED: myb-related protein 308-like
SwissprotP800731e-37MYB2_PHYPA; Myb-related protein Pp2
SwissprotQ50EX62e-38ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0L9VRC89e-45A0A0L9VRC8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SYT29e-45A0A0S3SYT2_PHAAN; Uncharacterized protein
TrEMBLV7AQZ01e-44V7AQZ0_PHAVU; Uncharacterized protein
STRINGGLYMA07G07960.18e-43(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.14e-45myb domain protein 17